← Back
diegosouzapw

diegosouzapw/OmniRoute

Never stop coding. Free MIT AI gateway: one endpoint, 359 providers (150+ free), 1200+ models Kimi, Claude, GPT, Gemini, GLM, DeepSeek, MiniMax. Works with Claude Code, Codex, Cursor, OpenCode, Cline & Copilot. Quota-aware auto-fallback, RTK+Caveman compression saves 15-95% tokens, MCP/A2A, Desktop/PWA. Built by hundreds of contributors

View on GitHub ↗https://omniroute.online ↗
a2aai-agentsai-gatewayanthropicclaudeclaude-codeclinecodexcopilotcursordeepseekfree-aigeminikimillm-gatewaymcpopenaiopenai-proxyqwentoken-saver
Stars
72.1K
Forks
10.3K
Watchers
72.1K
Open issues
552
Contributors
739
Language
TypeScript
License
MIT License
Default branch
release/v3.8.52
Created Feb 13, 2026Updated Oct 2, 2026

Star growth

Today—
This week—
This month—

Star history will appear here once this repo has been tracked for a couple of days.

README

OmniRoute Dashboard

🚀 OmniRoute — The Free AI Gateway

OmniRoute — Never stop coding. Every AI tool → 358 providers — 150+ free — through one endpoint. Claude Code, Codex, Cursor, Cline, Copilot & Antigravity into FREE Claude / GPT / Gemini with auto-fallback. RTK + Caveman stacked compression saves 15–95% tokens (~89% avg) — never hit limits. 358 AI providers · 150+ free tiers · ~1.62B free tokens/mo · 19 routing strategies · $0 to start.

💰 ~1.62B Free Tokens / Month

Stacking free tiers by hand is painful — dozens of SDKs, dozens of rate limits, and no idea how much you actually have. OmniRoute catalogs 489 free-tier entries across 35 recurring pool keys and computes the token headline from the 17 pools with a published positive monthly budget plus five per-model Groq caps, deduplicated by shared pool. Quotas that only open after a regional identity check (today: ModelScope) are shown apart, +~6M behind regional identity verification, and never summed into the headline. The result stays visible on the dashboard (/dashboard/free-tiers).

OmniRoute free-tier budget card: ~1.62B free tokens per month steady, up to ~2.22B in the first month with signup credits, from 35 documented recurring pool keys covering 489 cataloged free-tier entries behind one endpoint. Honest pool-deduped math — each shared pool counted once, including 17 recurring pools with a published positive monthly token budget plus five per-model Groq caps; 13 providers are marked avoid in the terms-risk catalog so you decide. Budget bar includes Mistral 1B, Nara 210M, LLM7 150M, xKiro 150M, Groq 30M (five per-model caps) and smaller pools, plus first-month signup credits and permanently-free no-token-cap providers surfaced separately so they never inflate the headline. Live used/remaining on /dashboard/free-tiers.

Animated summary of the live /dashboard/free-tiers page. Full methodology (pool dedupe, credit tiers, provider terms): docs/reference/FREE_TIERS.md.

These figures are re-audited every two weeks against the live catalog and move both ways — a provider ends a free tier and the number drops; a new one lands and it climbs. We publish what the catalog actually computes, never a rounded-up best case.


⭐ Star the repo if OMNIROUTE helped you save money and make your work easier.

Stars diegosouzapw%2FOmniRoute | Trendshift Star History Rank olud.ai

💬 Join the community

👋 Follow the maintainer — get new providers, releases & tips first:

Follow Diego on LinkedIn Follow @diegosouzapw on GitHub

Discord Telegram WhatsApp Global WhatsApp Brasil Website

Questions, provider tips, roadmap & support → Discord · Telegram · WhatsApp 🌍 Global / 🇧🇷 Brasil / Portal


📈 The Gateway Keeps Growing

v3.8.49 v3.8.50 v3.8.51+
🌐 Providers 290 357 more queued
🧠 Unique chat model IDs 1185 1312 —
🖼️ Modality Bridge — 🆕 vision + audio + video —
📡 Radar free catalog — 🆕 opt-in —
⚖️ Quota-aware scheduling — 🆕 Quota-Share —
📊 Quota telemetry — 🆕 live —

→ Roadmap — riding the rail to v3.9.0 LTS


🧩 Available

npm version NPM Monthly Docker Hub License: MIT Docker Pulls Electron Downloads

🚀 Start 🚀 Quick Start 📦 Install 🆓 Zero-config
💡 Learn 💥 The Promise 🤔 Why OmniRoute 🏆 What Sets Apart
⚙️ Features 🎯 Combos 🌐 Providers 🔌 CLI & MCP
🗜️ Compression 🖥️ Where It Runs 🔒 Private
👀 See it 🎬 In Action ✨ What's New 🤖 Compatible CLIs
💚 Support 💚 Support / Donate 💬 Community 💖 Sponsors
📦 Project 🛠️ Tech Stack 📖 Docs 👥 Contributors
🌐 In 67 languages

English (en) Português — Brasil (pt-BR) Português (pt) Español (es) Français (fr) Italiano (it) Deutsch (de) Nederlands (nl) Русский (ru) Українська (uk-UA) Polski (pl) Čeština (cs) Slovenčina (sk) Română (ro) Magyar (hu) Български (bg) Dansk (da) Suomi (fi) Norsk (no) Svenska (sv) 中文 — 简体 (zh-CN) 中文 — 繁體 (zh-TW) 日本語 (ja) 한국어 (ko) ไทย (th) Tiếng Việt (vi) Bahasa Indonesia (id) Bahasa Melayu (ms) Filipino (phi) हिन्दी (hi) ગુજરાતી (gu) मराठी (mr) தமிழ் (ta) తెలుగు (te) বাংলা (bn) اردو (ur) فارسی (fa) العربية (ar) עברית (he) Türkçe (tr) Azərbaycan (az) Kiswahili (sw) Ελληνικά (el) Hrvatski (hr) Српски (sr) Lietuvių (lt) Eesti (et) Latviešu (lv) Slovenščina (sl) Malti (mt) Gaeilge (ga) ಕನ್ನಡ (kn) മലയാളം (ml) ଓଡ଼ିଆ (or) ਪੰਜਾਬੀ (pa) नेपाली (ne) සිංහල (si) မြန်မာ (my) ខ្មែរ (km) Hausa (ha) Yorùbá (yo) Igbo (ig) አማርኛ (am) Oʻzbekcha (uz) ქართული (ka) Հայերեն (hy) Bosanski (bs)


🆓 Works the second you install it — no keys, no config

Works the second you install it — zero config. Three steps: 1. Install — npm i -g omniroute, server boots on localhost:20128. 2. Point your tool at http://localhost:20128/v1 — any OpenAI-compatible tool (Claude Code, Cursor, Cline). 3. It answers — call model auto for an instant reply, with no API key, no signup, no configuration. Keyless provider OpenCode Free is pre-wired into the auto combo, so a fresh install responds out of the box.

# Fresh install, zero credentials — `auto` already works:
curl http://localhost:20128/v1/chat/completions \
  -H "Content-Type: application/json" \
  -d '{"model":"auto","messages":[{"role":"user","content":"Hello!"}]}'

Prefer a specific free backend? Call oc/… (OpenCode Free) directly. Then graduate to auto and let OmniRoute pick.

📦 Copy-paste quickstart scripts for Python, Node.js, PHP, and cURL → examples/quickstart/


💥 The Promise

The Promise — One endpoint and 358 providers. Automatic fallback keeps routing while another healthy target is available. Six pillars: resilient fallback across 358 providers · up to 95% token savings on eligible workloads · $0 to start with 150+ free tiers and 54 recurring/keyless free-forever providers · 36 CLI/agent integrations through one config · OpenAI, Claude, Gemini and Responses API compatibility at /v1 · production controls including circuit breakers, TLS stealth, MCP 110 tools, A2A, memory, guardrails, evals and 39,000+ static test declarations across 5,100+ tracked test files.



🤔 Why OmniRoute?

Why OmniRoute — stop juggling 10 dashboards, dead API keys and surprise bills. Ten daily pains vs fixes: quota expiring unused → maximize subscriptions; rate limits mid-coding → 4-tier auto-fallback (Subscription → API → Cheap → Free); tool outputs burning tokens → RTK + Caveman compression (15–95%); expensive APIs → cost-optimized routing; every tool its own setup → one endpoint, one dashboard; AI blocked → 3-level proxy + TLS stealth; dead keys → 3-layer resilience (circuit breakers, key cooldown, model lockout); team sharing one subscription → key pools with fair-share quotas; prompts through someone's cloud → local-first with AES-256-GCM encrypted keys; no spend visibility → live analytics (usage, quota, savings, p95 latency).

OmniRoute request flow: your IDE or CLI (Claude Code, Cursor, Cline…) calls one local endpoint (http://localhost:20128/v1); the OmniRoute Smart Router (RTK + Caveman compression, 19 routing strategies, circuit breakers, TLS stealth, MCP, A2A, guardrails) can fall back across 4 provider tiers while an eligible healthy target remains — Tier 1 Subscription, Tier 2 API Key, Tier 3 Cheap and Tier 4 Free.

🤝 Supported by our Open Source Friends

Kimi K3 — Open Frontier Intelligence · 2.8T parameters · 1M-token context

Want to join as an Open Source Friend? These are the companies that back open source and help keep OmniRoute moving — and we say publicly where every token they give us goes. Reach out: diegosouza.pw@outlook.com

Kimi (Moonshot AI)
Kimi
Moonshot AI

Founding Open Source Friend
Thanks to Kimi (Moonshot AI), our founding Open Source Friend, for backing this project! Kimi is the AI lab behind the open-weight K2 and K3 model families — Kimi K3 delivers a 1M-token context window, native vision and frontier-level coding at a fraction of closed-model prices, and works out of the box with Claude Code, Codex and every coding tool OmniRoute serves.

What Kimi's support powers: Kimi's API credits power OmniRoute's AI-validated release pipeline — the merge validation powered by Kimi K3 stage that reviews every pull request before it ships — plus day-to-day feature development. First-class Kimi support ships on both rails: the direct Kimi API (kimi-k3) and the Kimi Code coding plan (OAuth and API key). OmniRoute is also the first Brazilian open-source project in Kimi's support program. Get a Kimi API key with 15% extra credits →
Cheaper Inference
Cheaper Inference
cheaperinference.com

Open Source Friend
Thanks to Cheaper Inference, an OmniRoute Open Source Friend, for backing this project! Cheaper Inference is a cost-ranked gateway that resells 42 frontier models — Claude, GPT-5.x, Gemini, Kimi K3, GLM, DeepSeek, Grok and MiniMax — behind one OpenAI-compatible endpoint, routing each request to the cheapest eligible provider without ever charging above the model maker's list price.

First-class support in OmniRoute: Chat Completions, the native /v1/responses endpoint, vision, tool calling and 3 image models (grok-imagine, nano-banana-pro, nano-banana-2, reachable as cheaperinference/<model>). Get an API key →

Links tagged aff=omniroute are partner links. They fund the project at no extra cost to you.


🎟️ Affiliates Promo — free signup coupons from providers we don't sponsor (click to expand)

This section is for referral/coupon codes only. Sponsored partnerships live in 🤝 Supported by our Open Source Friends above. OmniRoute has no sponsorship or partnership with the providers listed here — these are public coupons anyone can use.

AgentRouter
AgentRouter
agentrouter.org
AgentRouter — affiliate signup · $100 free credits on signup (free server, expect higher latency — best for testing, not production). First-class support in OmniRoute since v3.8.50: Chat Completions, the Anthropic-compatible wire format and the OpenAI-compatible path. Available models include claude-opus-4-8, claude-opus-5, gpt-5.6-sol and more. Grab your $100 →

⚠️ Affiliate link — OmniRoute has no sponsorship or partnership with this provider.

Know another provider with a generous free signup coupon that benefits OmniRoute users? Open an issue and we'll add it here.


🎯 Combos — The Flagship

All 19 combo routing strategies animated — one tile per strategy: priority, fill-first, weighted, round-robin, p2c, least-used, random, strict-random, cost-optimized, headroom, reset-window, reset-aware, context-relay, context-optimized, cache-optimized, lkgp, auto, fusion, pipeline. See the table above for what each one does.

A combo is a chain of models OmniRoute routes across automatically. If quota runs out, a provider fails, or costs spike, the combo can move to the next eligible healthy model. 🛡️

⚡ Zero-config — just use auto

No combo to create. Set your model to auto (or a variant) and OmniRoute builds a virtual combo from your connected providers, scored live:

Model IDWhat it optimizes for
auto🎯 Balanced default (LKGP — sticks to your last good provider)
auto/coding🧑‍💻 Quality-first weights for code generation
auto/fast⚡ Lowest latency first
auto/cheap💰 Cheapest per token first
auto/offline🔋 Most quota / rate-limit headroom first
auto/smart🔭 Quality-first + 10% exploration to discover better models
auto/lkgp📌 Explicit last-known-good-provider stickiness
auto/chaos🧪 Parallel fan-out to a panel of models (one per provider, 5 by default), returns one answer; one upstream call per panel model, not fault injection

🔀 Or build your own — 19 routing strategies

All 19 strategies — mix & match per combo step:

# Strategy What it does
1 priority First-target ordered list — drain each before the next 🥇
2 fill-first Fill each target's quota fully before moving on
3 weighted Weighted random by per-target weight
4 round-robin Cycle through targets in order
5 p2c Power-of-two-choices random load balancing
6 least-used Pick the target with the lowest current load
7 random Uniform random pick (deduplicated)
8 strict-random Random without de-duplicating repeats 🎲
9 cost-optimized Minimize $ per request from live catalog pricing 💸
10 headroom Pick the target with the most remaining quota
11 reset-window Prefer the target whose quota window resets soonest
12 reset-aware Rank by quota reset time — short windows first 📊
13 context-relay Hand off context across targets for long conversations 🧠
14 context-optimized Pick the best fit for the current context size
15 cache-optimized Pin each reusable prompt prefix to the same account — maximize prompt-cache hits 🎯
16 lkgp Last-Known-Good Path — pins to the last successful provider, then falls back to rules
17 auto 16-factor live scoring across every connection 🤖
18 fusion Fan out to a panel of models + a judge synthesizes one answer 🧬
19 pipeline Chain steps — each target's output feeds the next one 🔗

The Auto-Combo engine scores every candidate on 16 factors (health, quota, cost, latency, task fit, quality, session availability…) — see docs/routing/AUTO-COMBO.md.

🧱 Resilience is built in (3 independent layers)

OmniRoute resilience — 3 independent self-healing layers, the right layer for the right failure. Layer 1 provider circuit breaker (whole provider): trips only on 408/5xx, thresholds OAuth 8× / API-key 12× / local 2×, resets 60s/30s/15s into a HALF-OPEN probe, lazy recovery; while OPEN the combo reroutes to the next provider. Layer 2 connection cooldown (one key/account): base 5s OAuth / 3s API-key, exponential ×2 backoff with anti-thundering-herd guard, 429 honors Retry-After, success clears all error state; one cooling key is skipped while sibling keys keep serving. Layer 3 model lockout (one model): per-model 429, local 404 or mode denials lock just that model — never the whole connection. Terminal states (banned, expired, credits exhausted) are for the operator, not cooldowns.

📖 Auto-Combo Engine · Resilience Guide


🏆 What Sets OmniRoute Apart

What sets OmniRoute apart — a dated feature snapshot vs 9router, OpenRouter, CLIProxyAPI and LiteLLM across 13 capabilities. OmniRoute: 358 providers, 150+ free tiers built in, 19 routing strategies, 12-engine token compression, built-in MCP server with 110 tools, A2A agent protocol, persistent memory, guardrails, cloud agents, TLS fingerprint stealth, Desktop/Termux/PWA and 42 i18n UI locales. OmniRoute is MIT-licensed and self-hostable. Competitor capabilities and counts may change; see the linked methodology.

📊 Full methodology & per-feature detail vs 9router, OpenRouter, CLIProxyAPI & LiteLLM → docs/comparison/OMNIROUTE_VS_ALTERNATIVES.md


💚 Support OmniRoute

OmniRoute is MIT-licensed and maintained in the open. If it saves you time or money, here's how to keep it independent — pick whatever fits you. Sponsorship never affects routing priority; it buys visibility, not ranking.

⭐ Star the repoFree — genuinely helps visibilityStar OmniRoute
🐙 GitHub SponsorsOne-off or monthly · zero platform feegithub.com/sponsors/diegosouzapw
☕ Ko-fiQuick one-off tip, no signup for the donorko-fi.com/diegosouzapw
🧋 Buy Me a CoffeeSmall, informal gesturebuymeacoffee.com/diegosouzapw
🖐 LiberapayRecurring · non-profit · open sourceliberapay.com/diegosouzapw
🇧🇷 PIX (Brazil)Instant, no feeskey & QR below
₿ CryptoBTC · ETH · USDT-TRC20 · USDC-Solanaaddresses below

🇧🇷 PIX — instant, no fees (Brazil)

OmniRoute PIX QR code

Key (random): 5d865059-bc44-483a-962d-43ceb80126eb

Pix copia-e-cola:

00020101021126580014br.gov.bcb.pix01365d865059-bc44-483a-962d-43ceb80126eb5204000053039865802BR5922OMNIROUTE CONTRIBUICAO6006BRASIL62070503***630475DD

₿ Crypto — BTC · ETH · USDT-TRC20 · USDC-Solana (click to expand)
₿ BTCBitcoin (SegWit)bc1qh00smz004sy85wyl28v77tenkt3ckl6eaep7fd
Ξ ETHEthereum (ERC20)0x64Cf6B68A6Ff34288e89172950a2d00102337a84
₮ USDTTron (TRC20)TKAF41JpuQrHbKTnsQa9svJE2T192Hvsc2
$ USDCSolana2emNNZzVVWQc3FQ2wk9M6qXUQmW8AKdjjL174fXR28Tu

⚠️ Send each coin only on the network shown — sending on the wrong network can lose the funds.

🐛 Found a bug or have feedback? Open a Discussion.


Developer notes: The project may generate a local .env file during npm install/postinstall for developer convenience. This file is intentionally ignored via .gitignore (see .gitignore) and must never be committed — if accidentally committed, rotate any exposed secrets and remove the file from history. See docs/DEVELOPER-ENVIRONMENT.md for guidance on managing local environment files and secrets.

📡 OmniRoute Radar

The main free-tier headline remains ~1.62B tokens/month from the documented, pool-deduplicated catalog above. Temporary provider signup credits can separately lift the first month to ~2.22B. Radar is an optional, signed catalog overlay for people who want fresher free-model availability between OmniRoute releases; the community catalog and every existing free feature remain free.

Supporters can receive the live catalog and additional provider opportunities. Its separate, mutable ceiling is approximately 3B tokens/month at most, depending on provider availability. That ceiling is not a guarantee: providers can change quotas, eligibility, models, or regions at any time.

Radar is opt-in and GET-only. The OmniRoute client does not upload prompts, traffic, provider configuration, usage telemetry, or local announcement-dismiss state. Learn about eligibility and the current catalog at radar.omniroute.online/planos.


✨ What's New

Recent highlights from v3.8.20 → v3.8.50. Full history in CHANGELOG.md.

  • 🎛️ OmniConductor — inbound A2A delegation to your agent fleet, Conductor skills on the Agent Card, and a dashboard panel with Faro push-to-talk voice chat. → A2A Server
  • 🛂 Adaptive admission & overload protection — heavyweight chat requests queue instead of 503ing, with atomic RPM rolling leases per connection. → Resilience Guide
  • 🗂️ Canonical /v1/models ordering — one contiguous provider-grouped block per provider (combos pinned first), stable across every catalog source. → API Reference
  • 🗜️ Compression hardening — default-on inflation guard, Caveman packs for DE / FR / JA + Chinese (wényán), RTK filters for Gradle & .NET. → Compression
  • 💸 Honest flat-rate cost — subscription / coding-plan providers read $0 in cost analytics; budget, quota & routing keep estimating. → API Reference
  • ⚖️ Quota-Share routing — split a shared account's quota fairly across pooled keys, work-conserving so idle slices are lent out. → Resilience Guide
  • 🤖 One-command CLI/agent setup — 13 registered setup-* commands; omniroute run launches 7 CLIs (Claude Code, Codex, Aider, Goose, OpenCode, Qwen Code, Gemini CLI); omniroute configure supports 10 targets with an interactive provider+model picker and per-context favorites. → CLI Integrations
  • 🛰️ Remote mode — drive a remote OmniRoute with scoped tokens (connect / contexts / tokens) + an antigravity OAuth helper for VPS installs. → Remote Mode
  • 🧭 Smarter auto-routing — auto/<category>:<tier> combos, Fusion (model panel + judge), task-aware routing, per-request model / mode / USD-budget overrides. → Auto-Combo
  • 🗜️ Pluggable compression — 12 composable engines + Compression Studios: LLMLingua-2, two-tier Ultra, omniglyph, per-step fidelity gate, GCF v3.2, drag-reorder editor. → Compression
  • 🕵️ Transparent MITM decrypt (TPROXY) — capture CLIs that ignore proxy env vars, with a per-SNI CA + trust-store installer. → MITM/TPROXY
  • 💸 Cost telemetry everywhere — X-OmniRoute-* cost/usage headers on every endpoint, cache-HIT savings header, per-key USD spend quotas. → API Reference
  • 🧠 Memory you control — off by default, opt-in int8 vector quantization + typed decay, per-request x-omniroute-no-memory. → Memory
  • 🛡️ Security — prompt-injection guard on every LLM route (red-team suite), opt-in credential-masking guardrail (redacts leaked API keys/secrets in both directions), free DuckDuckGo last-resort web search, and an optional OIDC login gate for the dashboard (password login always stays available). → Guardrails
  • 🖼️ New endpoints — /v1/ocr (Mistral OCR) and /v1/audio/translations (Whisper-style) round out the media surface. → API Reference
  • 🎨 Image / video / audio generation — one API for media: xAI Grok Imagine & Novita AI video, ComfyUI, Magnific, Adobe Firefly, Segmind, and speech providers such as ElevenLabs. → API Reference
  • 🌍 Deployment & ops — reverse-proxy basePath, browser-language auto-detect, per-key device tracking, root-less MITM trust, zh-TW localization. → Environment
  • 🤝 More providers & agents — cloud agents (Codex Cloud, Cursor, Devin, Jules), Grok Build (xAI) with browser + OAuth login, Ollama first-class card, Claude Opus 5 & Sonnet 5, Kimi official partnership (Code/Web/Moonshot), Zed, Requesty, SenseNova, Yuanbao, Agnes AI… and a refreshed 352-provider catalog. → Providers
  • 📡 Routing transparency — every response carries an X-OmniRoute-Decision header naming the strategy/provider/latency that served it, a new cache-optimized combo strategy + Auto-Combo cacheAffinity factor route repeat requests back to the connection holding the cached prefix, and a read-only /v1/auto-combo/{channel}/candidates endpoint exposes an auto/* channel's live candidate pool. → Auto-Combo
  • ⚡ Local performance & infra — one-click local Redis, Cloudflare Workers / Deno Deploy relay deployers, Bifrost & Mux as supervised embedded services. → Embedded Services
  • 🧩 Also in the box — plugin framework + marketplace, Omni/Agent/GitHub skills frameworks, Obsidian vault integration (22 MCP tools), OpenAI-compatible Batch & Files APIs, semantic response cache, gamification with leaderboards, ACP agent discovery (15 built-in agents), scheduled log export to BigQuery, auto/chaos parallel multi-model fan-out, a Telegram bot bridge, an in-app version manager and LMArena-ELO free-provider rankings. → Docs

🤖 Compatible CLIs & Coding Agents

One config — http://localhost:20128/v1 — and every AI IDE or CLI runs on free & low-cost models.

Claude Code
Claude Code
                           
Codex CLI
Codex CLI
                           
Cline
Cline
                           
Kilo Code
Kilo Code
Zoo Code
Zoo Code
Continue
Continue
                           
Aider
Aider
                           
ForgeCode
ForgeCode
                           
jcode
jcode
                           
DeepSeek TUI
DeepSeek TUI
                           
CodeWhale
CodeWhale
                           
OpenCode
OpenCode
                           
Factory Droid
Factory Droid
                           
GitHub Copilot CLI
Copilot CLI
                           
Cursor CLI
Cursor CLI
                           
Smelt
Smelt
                           
Pi (pi-coding-agent)
Pi
                           
Grok Build (xAI)
Grok Build
                           
Hermes Agent (Nous Research)
Hermes Agent
                           
OpenClaw
OpenClaw
                           
Goose
Goose
                           
Open Interpreter
Open Interpreter
                           
Warp AI
Warp AI
                           
deyin.ai
deyin.ai
                           
+ also works with · Agent Deck · Kiro · Command Code · Antigravity · Windsurf · AMP · any OpenAI-compatible tool

📖 Per-tool setup for all 36 tools (26 CLI Code's + 10 CLI Agents) → docs/reference/CLI-TOOLS.md · 🧩 OpenCode plugin → @omniroute/opencode-provider


Launch any supported CLI through OmniRoute in one command — no config files written, credentials injected per process, Qwen/Gemini get a throwaway isolated home:

omniroute run claude   --model openai/gpt-5.4          # Claude Code
omniroute run codex    --model glm/glm-5.2             # OpenAI Codex CLI
omniroute run aider    --model glm/glm-5.2 -- --message "reply OK"
omniroute run goose    --model glm/glm-5.2
omniroute run opencode --model glm/glm-5.2 -- run "reply OK"
omniroute run qwen     --model glm/glm-5.2 -- -p "reply OK"
omniroute run gemini   --model glm/glm-5.2 -- --skip-trust -p "reply OK"

# Or pick provider+model interactively and write the tool's own config:
omniroute configure codex          # also: claude opencode qwen aider goose gemini cline continue kilo

Every command honors the active remote context (omniroute connect <host>), --dry-run previews the exact env/args without executing, and --api-key-env NAME keeps secrets out of your shell history. → CLI Integrations


🌐 357 AI Providers — 152 Catalog-Marked Free

357 registered providers across the canonical chat, media, search, local, cloud-agent and system collections, including 152 carrying hasFree: true discovery metadata. The chat model registry covers 229 providers / 2,554 distinct provider-model pairs / 1,283 raw model IDs; the separate free-budget catalog has 491 per-model rows, 35 recurring pools and 54 recurring/keyless free-forever providers. These are different denominators by design; definitions and pool-deduped calculations live in the Provider Reference and Free Tiers.

🏢 Every major lab — through one endpoint

OpenAI
OpenAI
                           
Anthropic
Anthropic
                           
Gemini
Gemini
                           
xAI Grok
xAI Grok
                           
DeepSeek
DeepSeek
                           
Mistral
Mistral
                           
Qwen
Qwen
                           
Meta Llama
Meta Llama
                           
Groq
Groq
                           
NVIDIA
NVIDIA
                           
MiniMax
MiniMax
                           
Cohere
Cohere
                           
Perplexity
Perplexity
                           
Hugging Face
HuggingFace
                           
Together
Together
                           
Fireworks
Fireworks
                           
Cloudflare
Cloudflare
                           
Baidu
Baidu
                           

…and 330+ more — every icon resolves live from the dashboard's provider catalog. 📖 Provider Reference


🆓 Free Forever — $0, no card

OpenCode Zen
OpenCode Zen
DeepSeek V4, Nemotron 3
No token cap
Kilo Code
Kilo Code
Auto-router, Tencent Hy3
Free forever
Requesty
Requesty
GPT-OSS 120B, Nemotron
Free forever
SiliconFlow
SiliconFlow
DeepSeek V3.2 / R1
Free tier
Z.AI GLM
Z.AI GLM
GLM-4.7 / 4.5-Flash
Free forever
Baidu ERNIE
Baidu ERNIE
ERNIE 4.0
Free forever
Qoder AI
Qoder AI
Qwen3-Max, Kimi-K2
Unlimited FREE
Pollinations
Pollinations
GPT, Llama, Claude
No key needed
Cloudflare AI
Cloudflare AI
50+ models
10K neurons/day
NVIDIA NIM
NVIDIA NIM
GLM, MiniMax
~40 RPM free
Cerebras
Cerebras
GLM 4.7, GPT-OSS
1M tokens/day
OpenRouter
OpenRouter
:free models
+$10 → higher RPM

📖 Full machine-readable catalog → docs/reference/PROVIDER_REFERENCE.md


🖥️ Where OmniRoute Runs — Anywhere

Same app, your machine, your rules. From a global npm install to your phone via Termux.

PlatformInstallHighlights
📦 npm (global)npm install -g omnirouteOne command, any OS
🐳 Dockerdocker run … diegosouzapw/omnirouteMulti-arch AMD64 + ARM64
🖥️ Desktop (Electron)npm run electron:buildNative window + system tray — Windows / macOS / Linux
🎩 Menu-bar (OmniRouteTray)brew install --cask zoispag/tap/omniroute-traySupervises & auto-updates the server — macOS
💪 ARMnative arm64Raspberry Pi, ARM servers, Apple Silicon
📱 Android (Termux)pkg install nodejs && npx -y omnirouteRuns on your phone, 24/7, no root
📲 PWA"Add to Home Screen"Fullscreen, offline, installable from browser
🧩 OpenCode plugin@omniroute/opencode-providerNative OpenCode integration
🤖 VS Code Copilot Chatinstall OmniCopilot extensionEvery OmniRoute model in the native Copilot Chat picker — stable & Insiders
🛠️ From sourcenpm install && npm run devHack on it, contribute

📖 Docker Guide · Desktop · Menu-bar tray · Termux · PWA · OpenCode


🧩 New: OmniRoute inside VS Code's native Copilot Chat

No new sidebar, no new chat UI — every model OmniRoute serves shows up right in the Copilot Chat model picker you already use. Since VS Code 1.122, provider models work without a GitHub sign-in or a Copilot subscription — agent mode, tool calling and vision, for free.

Install the OmniCopilot extension, point it at your OmniRoute server (defaults to localhost:20128), then open Copilot Chat → model picker → Manage Models… → OmniRoute.

StoreLinkWorks with
🧩 VS Code MarketplaceInstall →VS Code — stable & Insiders
🔓 Open VSX RegistryInstall →Cursor, Windsurf, VSCodium, Theia, code-server, Gitpod, Antigravity, Kiro…

From inside the editor: open the Extensions view, search "OmniRoute", click Install — works the same way on both stores. Source, issues and the publishing runbook live at diegosouzapw/OmniCopilot.

📖 VS Code Copilot Chat guide — setup, what the picker shows, dashboard-in-a-tab, troubleshooting


🎩 New: OmniRouteTray — your gateway, living in the menu bar

omniroute serve is happiest when it's always on. OmniRouteTray turns that into a set-and-forget menu-bar app for macOS: it starts the server, keeps it alive across reboots, updates it in place, and puts your live token budget one click away — no terminal window left open, no npm install -g omniroute to babysit.

Built with Tauri v2 (a Rust core the size of a rounding error), it ships its own signed Node 24 runtime and manages an app-owned OmniRoute install, so it never fights your global node/bun. It shares your existing ~/.omniroute/ config and database — so it's the same OmniRoute you already run, just with a hat on. 🎩

What it doesHow
🟢 Supervises the serverSpawns omniroute serve, adopts an already-running instance instead of duplicating it
📊 Live usage at a glanceProvider quota bars, Claude session/weekly limits with reset countdowns, 30-day cost breakdown
🔄 Auto-updates in placeStaged install, atomic swap, rollback on failure — always on the newest release
🚀 Start on loginOptional launch at login; tray-only, no dock icon
🩺 Doctor & logsOne-click diagnostics and server log access
brew install --cask zoispag/tap/omniroute-tray

Prefer a download? Grab the latest .dmg from Releases. Source, issues and build docs live at zoispag/omniroute-tray.
💛 A community project by @zoispag — not an official OmniRoute release.


🔒 Private & Local-First

Private and local-first — OmniRoute's gateway and control plane run on your machine. Prompts are sent to the upstream provider selected for each request; OmniRoute adds no hosted prompt-processing hop and telemetry is disabled by default. Credentials are encrypted at rest with AES-256-GCM; controls include API-key scoping, IP filtering, rate limits, prompt-injection guards, upstream-header scrubbing, opt-in PII redaction, sanitized errors and a local SQLite audit trail. OmniRoute is MIT-licensed and self-hostable.

📖 Authorization · Guardrails · Compliance


🔌 Full CLI + A2A & MCP

Beyond the server, OmniRoute is a full command-line cockpit with 80+ commands, plus open agent protocols so an AI agent can drive it on its own.

⌨️ A real CLI (not just start)

omniroute               # serve gateway + dashboard (port 20128)
omniroute chat          # interactive TUI chat client (slash: /model /combo /skill /memory)
omniroute setup         # guided first-run wizard
omniroute doctor        # diagnose providers, ports, native deps

🛰️ Remote mode — run the CLI here, OmniRoute on a VPS

OmniRoute on a server? Drive it from your laptop with the same CLI. Log in once with a scoped access token; every command then targets the remote.

omniroute connect 192.168.0.15            # password → scoped token, saved as a context
omniroute models                         # ← runs against the REMOTE server
omniroute configure codex                 # ← picks a remote model, writes a local Codex profile
omniroute tokens create --name ci --scope read   # mint narrower tokens for other machines
omniroute contexts use default            # ← switch back to the local server

Tokens are scoped read / write / admin; process-spawning routes stay loopback-only. 📖 Remote Mode

Animated terminal demoing the OmniRoute CLI — omniroute providers list, omniroute combo list and omniroute health — cycling over the 86-command top-level surface: providers · oauth · keys · combo · nodes · models · cache · compression · cost · usage · quota · health · resilience · telemetry · logs · audit · mcp · a2a · cloud · memory · skills · eval · tunnel · backup · sync · webhooks · policy · pricing · translator · simulate …

🤝 Connect an agent — and it controls OmniRoute itself

Expose OmniRoute over MCP, A2A, a REST API, webhooks or a remote CLI — any capable agent (or your own code) gets the keys to the whole gateway: routing, providers, combos, cache, compression, memory — autonomously. HTTP endpoints below are served under http://localhost:20128.

InterfaceEndpoint / commandUse it for
🧰 MCP (stdio)omniroute --mcpPlug into Claude Desktop, Cursor, any MCP client
🌊 MCP (HTTP)/api/mcp/streamRemote MCP — 110 tools, 33 scopes (enforcement opt-in), full audit trail
📡 MCP (SSE)/api/mcp/sseStreaming MCP transport
🤝 A2A/.well-known/agent.jsonAgent-to-agent, JSON-RPC 2.0 + SSE, 6 skills
🌐 REST API/v1/*OpenAI-compatible — chat, embeddings, images, audio, OCR
🔔 Webhooks/api/webhooksPush request / quota events to Slack, Discord, Telegram or any URL
🛰️ Remote CLIomniroute connect Drive a remote instance with scoped access tokens
# Give Claude Code the full OmniRoute toolset over MCP:
claude mcp add-server omniroute --type http --url http://localhost:20128/api/mcp/stream

📖 MCP Server · A2A Server · Agent Protocols


🗜️ Save 15–95% Tokens — Automatically

📖 How it works — pipeline, architecture & savings math

OmniRoute compression pipeline: an illustrative 10,000-token client request passes through 12 composable engines — Session-Dedup, CCR, Lite, RTK, Responses Tool Output, Headroom, Relevance, Caveman, Aggressive, LLMLingua-2, Ultra and OmniGlyph — and can reach the provider at about 1,080 tokens in the documented stacked example. Structured content is protected by preservation guards and per-step fidelity gates; explicit lossy or experimental modes may transform eligible content.

Default stacked combo runs RTK → Caveman. When both act on the same tool/context payload, savings compound:

combined = 1 − (1 − RTK) × (1 − Caveman_input)
average  = 1 − (1 − 0.80) × (1 − 0.46) = 89.2%
range    = 78.4 – 94.6%

Code blocks, URLs, JSON and structured data are always protected by the preservation engine.

Why use many tokens when few tokens do the trick? Every request passes through OmniRoute's compression pipeline transparently — no client changes. It's now a stack of 12 composable engines that run in order and mix & match per routing combo — building on ideas from RTK, Caveman (⭐ 90K+), LLMLingua-2, and Troglodita (PT-BR).

🧱 The 12-engine stack

Engines run in pipeline order; each is independently toggleable and configurable per combo:

#EngineWhat it does
1Session-DedupDrops content repeated across turns (content-addressed, cross-turn)
2CCRArchives large blocks behind retrieve markers, fetched on demand
3LiteWhitespace + image-URL trimming (latency-light baseline)
4RTKSmart tool-result filtering, dedup & truncation (command-aware)
5Responses Tool OutputLossless-first JSON + bounded diagnostic compression for shell/patch/search/build outputs (Responses API)
6HeadroomLossless tabular compaction of JSON arrays (~30%) via a vendored GCF codec
7RelevanceExtractive sentence scoring against the last user query
8CavemanRule-based prose compression (~65–75% on output)
9AggressiveSummarization + progressive aging of old turns
10LLMLingua-2ML semantic pruning via MobileBERT ONNX — code-safe, async
11UltraHeuristic token pruning with an optional small-model (SLM) tier
12OmniGlyphExperimental context-as-image encoding for measured Claude Fable 5 on the direct Anthropic wire; GPT 5.6 transformers remain fail-closed pending provider receipts. Four compression profiles (aggressive default, balanced, coding-safe, passthrough) (most aggressive; opt-in)

Code blocks, URLs and structured data are always preserved byte-perfect. One-click presets combine the engines:

ModeSavingsBest for
🪶 Lite~15%Always-on safe default
🪨 Standard (Caveman)~30%Daily coding
⚡ Aggressive~50%Long tool-heavy sessions
🔥 Ultra~75%Maximum savings
🧰 RTK60–90%Shell/test/build/git output
🔗 Stacked (RTK → Caveman)78–95%Mixed prompts + tool logs

Real example — Standard mode:

Before (69 tokens): "The reason your React component is re-rendering is likely because you're creating a new object reference on each render cycle. When you pass an inline object as a prop, React's shallow comparison sees it as a different object every time, which triggers a re-render. I would recommend using useMemo to memoize the object."

After (19 tokens): "New object ref each render. Inline object prop = new ref = re-render. Wrap in useMemo."

Same answer. 72% fewer tokens. Zero accuracy loss. ✅

PT-BR example — Troglodita mode:

Antes (42 tokens): "O problema é que o componente está re-renderizando porque uma nova referência de objeto está sendo criada em cada ciclo de renderização. Eu recomendaria usar useMemo."

Depois (12 tokens): "Re-render: ref nova cada ciclo (objeto inline recriado). Usar useMemo."

Mesma resposta. ~70% menos tokens. Precisão técnica intacta. ✅


🎚️ Beyond the engines — output styles, the adaptive dial & per-request control

The 12 engines above shrink what goes in. Three more layers shape how, when, and what comes out:

  • 🪄 Output Styles (output-axis steering) — inject deterministic, cache-safe response-shaping instructions; combinable, each at lite / full / ultra intensity. Adding a style is a one-line registry entry:
    • Terse prose — drop filler / articles / hedging; keep technical substance exact.
    • Less code — "lazy senior dev" YAGNI: smallest working change, no unrequested scaffolding.
    • Ponytail (lazy senior dev) — climb the YAGNI ladder, fix the root cause, smallest working diff.
    • I have ADHD (action-first) — next action leads, steps numbered, one concrete next step, no preamble.
    • Terse CJK (文言) — classical-Chinese ultra-terse style (locale-gated to zh).
  • 🎯 Adaptive context-budget (the dial) — instead of one on/off token threshold, escalate the cheapest, most-lossless engines only as far as needed to fit the model's context window. Policy: reserve-output (default, model-aware) · percentage · absolute. Mode: floor (guarantee fit) · replace-autotrigger (your explicit choice wins) · off (legacy threshold).
  • 🎛️ Where compression is decided (precedence, high → low) — per-request x-omniroute-compression header › routing-combo override › active named profile › adaptive / auto-trigger › panel default › off. The applied plan echoes back in the X-OmniRoute-Compression: <mode>; source=<source> response header.

Auto-trigger by token threshold, flip on the adaptive dial, pin a named profile, set a one-off per request, or assign a pipeline per routing combo — whichever fits the workload. An opt-in offline eval harness (npm run eval:compression) scores fidelity vs. savings on a pinned corpus before you promote a change.

📖 COMPRESSION_GUIDE.md · RTK_COMPRESSION.md · COMPRESSION_ENGINES.md


⚡ Quick Start

1) Install & run

npm install -g omniroute
omniroute

💡 See npm warn ERESOLVE or peer-dep warnings? They're harmless. Using Gemini Web or another web-cookie provider? The npm package includes Playwright but not its Chromium binary. See the Playwright Chromium setup note before making the first web-provider request.

Dashboard at http://localhost:20128 · API at http://localhost:20128/v1.

2) Connect a FREE provider (no signup)

Dashboard → Providers → connect Kiro AI (free Claude, ~50 credits/month per account) or OpenCode Free (no auth) → done.

3) Point your coding tool

Base URL: http://localhost:20128/v1
API Key:  [copy from Dashboard → Endpoints]
Model:    auto            (zero-config smart routing — or any provider/model)

4) Verify it's working

curl http://localhost:20128/v1/models -H "Authorization: Bearer YOUR_KEY"

You should see your connected models listed. 🎉 That's it — start coding, and OmniRoute auto-routes & falls back for you.

If your client cannot send custom headers, OmniRoute also exposes tokenized compatibility aliases:

OpenAI catalog:   http://localhost:20128/vscode/YOUR_KEY/
OpenAI models:    http://localhost:20128/vscode/YOUR_KEY/models
OpenAI chat:      http://localhost:20128/vscode/YOUR_KEY/chat/completions
OpenAI responses: http://localhost:20128/vscode/YOUR_KEY/responses
Ollama chat:      http://localhost:20128/vscode/YOUR_KEY/api/chat
Ollama tags:      http://localhost:20128/vscode/YOUR_KEY/api/tags

Use these only for clients that cannot attach Authorization: Bearer .... Header auth remains the preferred mode.


📦 More install methods — Docker, source, pnpm, Arch

🐳 Docker

docker run -d --name omniroute --restart unless-stopped --stop-timeout 40 \
  -p 127.0.0.1:20128:20128 -v omniroute-data:/app/data diegosouzapw/omniroute:latest

:latest follows the highest published stable SemVer. It does not track git main. Pin :X.Y.Z for GitOps. See Docker Release Channels.The image pins OMNIROUTE_MEMORY_MB=1024. That is enough for the dashboard and a light chat. Coding agents (POST /v1/responses from Claude Code, Codex, Grok, …) need a much larger V8 heap or the process FATAL ERRORs at ~12 GiB under two overlapping long contexts. Size the container above the heap (native buffers sit outside V8):

Workload Heap (-e OMNIROUTE_MEMORY_MB) Container (--memory)
Dashboard / light chat 1024 (image default) ≥2 g
One coding agent 8192 ≥10 g
Two concurrent long /v1/responses 10240–12288 ≥12–16 g
docker run -d --name omniroute --restart unless-stopped --stop-timeout 40 \
  -e OMNIROUTE_MEMORY_MB=8192 --memory=10g \
  -p 127.0.0.1:20128:20128 -v omniroute-data:/app/data diegosouzapw/omniroute:latest

Full table: Docker Guide — runtime RAM.

Pre-release Docker channel: diegosouzapw/omniroute:next and diegosouzapw/omniroute:next-web follow the current default release/v* branch. These mutable tags are intended only for testing unreleased fixes and are not supported for production. See Docker Release Channels.

🥟 Bun

Standard bun install and global installation (bun install -g omniroute) are supported via Bun runtime detection:

  • Built-in bun:sqlite: OmniRoute uses Bun's built-in bun:sqlite driver when running under Bun, falling back to better-sqlite3 on Node.js or sql.js.
  • Automatic Webpack bundler selection in dev: Development (bun run dev) automatically detects Bun and disables Turbopack in favor of Webpack to prevent native V8 binding incompatibilities. Production builds (bun run build) follow OMNIROUTE_USE_TURBOPACK exactly as on Node: Turbopack by default, OMNIROUTE_USE_TURBOPACK=0 to build with Webpack (Dockerfile.bun exposes it as a --build-arg).
  • Dedicated Bun Dockerfile: Multi-stage Dockerfile.bun for native Bun production deployments (docker build -f Dockerfile.bun -t omniroute:bun .).
# Install and run with Bun
bun install
bun run dev

🛠️ From source

cp .env.example .env && npm install
PORT=20128 npm run dev

📦 pnpm

pnpm add -g omniroute@latest --allow-build=better-sqlite3 --allow-build=@swc/core && omniroute

🐧 Arch Linux (AUR)

yay -S omniroute-bin && systemctl --user enable --now omniroute.service

🔧 Nix (Flake)

# Using Nix flakes
nix develop
npm run dev

# Or using devbox
devbox run npm run dev

📖 Docker Guide — Compose profiles, Caddy HTTPS, Cloudflare tunnels.

🦭 Podman

# 1. Prepare the bind-mounted data directory
mkdir -p data

# 2. Linux + local rootless Podman only (never a remote Podman Machine client):
podman unshare chown 1000:1000 ./data

# 3. Set the runtime hint, build the local Compose image, and start
echo "CONTAINER_HOST=podman" >> .env
podman compose --profile base up -d --build

On macOS or Windows, Podman uses a remote Podman Machine: skip podman unshare and follow the topology-specific data directory guidance.

📖 Podman Guide — Compose builds, Podman Machine, and Linux/systemd Quadlet setup.

⚡ Faster / leaner install (skip the native build)

The native SQLite engine (better-sqlite3) is an optional dependency, so a global install never blocks on compiling from source: it uses a prebuilt binary when one matches your platform/Node, and otherwise falls back transparently to a pure-JS engine (node:sqlite on Node 22+, else the bundled sql.js WASM) — no build tools required.

To skip the post-install native warm-up entirely (CI, headless, or slow machines). Note: this only skips the native SQLite warm-up step (scripts/postinstall.mjs); the binary-copy/repair hook (scripts/build/postinstall.mjs) still runs normally:

OMNIROUTE_SKIP_POSTINSTALL=1 npm install -g omniroute   # CI=1 also skips it

For the fastest installs prefer pnpm (content-addressed store + hard links — see above). For a dashboard-free, headless runtime use the Docker base profile (above) or the Termux guide. The CLI and the web dashboard are served by the same process on one port, so there is no separate CLI-only package today.


🎬 OmniRoute in Action

📹 Video Guides

Snapshot do painel em 2026-08-24 · Catálogo bruto: YT 809 | TT 137 | IG 124 · Frescor (dias): YT 1 | TT 21 | IG 22

Instagram Reel
🎬 #1 — Instagram
nick_saraev — 3,042,474 views
Instagram Reel — theopenstack
🎬 #2 — Instagram
theopenstack — 692,419 views
TikTok — milesreevesai
🎬 #3 — TikTok
milesreevesai — 620,400 views
YouTube — Vaibhav Sisinty
🎬 #4 — YouTube
Vaibhav Sisinty — 391,109 views
Instagram Reel — buildwithai.club
🎬 #5 — Instagram
buildwithai.club — 347,652 views

Ranking completo (URLs canônicas deduplicadas, v > 0, maior alcance):

#1 #2 #3 #4 #5
nick_saraev — Instagram — 3,042,474 theopenstack — Instagram — 692,419 milesreevesai — TikTok — 620,400 Vaibhav Sisinty — YouTube — 391,109 buildwithai.club — Instagram — 347,652
#6 #7 #8 #9 #10
nivedan.ai — Instagram — 331,973 vaibhavsisinty — Instagram — 263,744 Nick Automates — YouTube Shorts — 218,174 theroshankrishna — Instagram — 186,786 midudev — TikTok — 177,800

Métricas canônicas em 2026-08-24: 1.029 vídeos únicos · 11.132.922 visualizações conhecidas (v > 0) · 639 canais/perfis por rede. O painel bruto contém 1.070 linhas; 41 duplicatas do Instagram foram normalizadas pela URL canônica, mantendo a maior contagem por vídeo.

🎬 Made a video about OmniRoute? Open an issue or discussion with the link — we'll feature it here.


📧 Community & Help

Everything in one place — follow the maintainer, chat with the community, or open an issue.

Channel Where / how
💼 LinkedIn — follow the maintainer linkedin.com/in/diegosouzapw
🐙 GitHub — follow for releases & tips @diegosouzapw
💬 Discord discord.gg/U47eFqAXCn
✈️ Telegram t.me/omnirouteOficial
🟢 WhatsApp — 🌍 Global join the group
🟢 WhatsApp — 🇧🇷 Brasil entrar no grupo
🌍 Website omniroute.online
🌍 🌍StHub OmniRoute Community (free) portal sthub
📦 Source code github.com/diegosouzapw/OmniRoute
🐛 Report a bug open an issue — attach npm run system-info output
🤝 Contribute CONTRIBUTING.md · Branching & Release Model · pick a good first issue
💚 Support the project Ways to support ↑ · GitHub Sponsors


🛠️ Tech Stack

LayerTechnology
RuntimeNode.js 22.x / 24.x LTS — >=22.22.2 <23 || >=24.0.0 <27
LanguageTypeScript 6.0 — 100% TypeScript across src/ and open-sse/ (zero any in core since v2.0)
FrameworkNext.js 16 + React 19 + Tailwind CSS 4
Databasebetter-sqlite3 (SQLite, WAL journaling) + LowDB (JSON legacy) — 136 domain modules, 193 migrations
MemorySQLite FTS5 full-text + int8-quantized vector embeddings, typed decay
SchemasZod 4 — MCP tool I/O validation + API contracts
ProtocolsMCP (stdio / HTTP / SSE) + A2A v0.3 (JSON-RPC 2.0 + SSE)
StreamingServer-Sent Events (SSE) + WebSocket bridge (/v1/ws)
Compression12-engine pipeline — RTK, Caveman, LLMLingua-2 (MobileBERT ONNX), GCF, OmniGlyph
Auth & securityOAuth 2.0 (PKCE) + JWT + API Keys + MCP scoped auth · AES-256-GCM at rest · DOMPurify
Stealthwreq-js — JA3 / JA4 TLS fingerprint impersonation, 3-level proxy
ResilienceCircuit breaker, exponential backoff, anti-thundering-herd, auto-combo self-healing
Loggingpino — structured JSON logs with request context
TestingNode.js test runner + Vitest — 39,000+ static test declarations across 5,100+ tracked test files (unit, integration, E2E, security, ecosystem)
PlatformsDesktop (Electron) · Android (Termux) · PWA (any browser)
CI/CDGitHub Actions — auto npm publish + Docker Hub on release
LinksWebsite · npm · Docker Hub

📖 Documentation

📘 Getting Started

DocumentDescription
User GuideProviders, combos, CLI integration, deployment
Setup GuideFull install methods, CLI tool configs, protocol setup, timeout tuning
CLI Tools GuidePer-tool setup for Claude Code, Codex, Cursor, Cline, OpenClaw, Kilo, Copilot
Remote ModeDrive a remote OmniRoute (VPS) from your laptop CLI via scoped access tokens
Claude Code ConfigPoint Claude Code at OmniRoute (local/remote) with launch + per-model profiles
Quick Start3-step install → connect → configure

🔧 Operations & Deployment

DocumentDescription
Docker GuideDocker run, Compose profiles, Caddy HTTPS, tunnels, image tags
Podman GuideQuadlet systemd integration, podman-compose, SELinux
VM DeploymentComplete guide: VM + nginx + Cloudflare setup
Fly.io DeploymentDeploy to Fly.io with persistent storage
Termux GuideRun OmniRoute on Android via Termux
PWA GuideProgressive Web App install, caching, architecture
Uninstall GuideClean removal for all install methods
Environment ConfigComplete .env variables and references

🧠 Features & Architecture

DocumentDescription
ArchitectureSystem architecture, data flow, and internals
Compression Guide7-option pipeline: off / lite / standard / aggressive / ultra / RTK / stacked
RTK CompressionCommand-output compression, filters, trust, verify, raw-output recovery
Compression EnginesCaveman, RTK, stacked pipelines, dashboard/API/MCP surfaces
Compression Rules FormatJSON rule-pack schemas for Caveman and RTK filters
Compression Language PacksLanguage detection and Caveman rule-pack authoring
Resilience GuideCircuit breakers, cooldowns, queue, anti-thundering herd, TLS spoofing
Auto-Combo Engine16-factor scoring, mode packs, self-healing
Proxy Guide3-level proxy system, 1proxy marketplace, registry CRUD
Free TiersConsolidated directory: 35 documented recurring pools / 489 cataloged free-tier entries
Features GalleryVisual dashboard tour with screenshots
Codebase DocumentationBeginner-friendly codebase walkthrough

🤖 Protocols & APIs

DocumentDescription
API ReferenceAll endpoints with examples
OpenAPI SpecOpenAPI 3.0 specification
MCP Server110 MCP tools, IDE configs, Python/TS/Go clients
MCP Server GuideMCP installation, transports, and tool reference
A2A ServerJSON-RPC 2.0 protocol, skills, streaming, task mgmt
A2A Server GuideA2A agent card, tasks, skills, and streaming

📋 Project & Quality

DocumentDescription
ContributingDevelopment setup and guidelines
Branching & Release ModelWhere PRs target (release/*), what main and tags mean
ChangelogFull per-version release history
Security PolicyVulnerability reporting and security practices
i18n Guide42-language support, translation workflow, RTL
Release ChecklistPre-release validation steps
Coverage PlanTest coverage strategy for 39,000+ static test declarations across 5,100+ tracked test files

⭐ Top Contributors

OmniRoute is shaped by a passionate open-source community. These individuals have made exceptional contributions that directly impact the quality, stability, and reach of the project. Thank you.

External contributors by merged pull requests

RankContributorMerged PRs~Changed lines
1backryun190227,977
2oyi77180407,678
3rdself14580,663
4JxnLexn128387,049
5KooshaPari101125,747
6herjarsa88230,872
7RaviTharuma7955,106
8maxmad64bis69394,715
9artickc5933,260
10HouMinXi5147,334
10chirag127515,153
12xz-dev50245,976
13hartmark4752,185
14rqzbeh39143,181
15dhaern3419,559
16Dingding-leo331,986
17NomenAK3213,854
18MumuTW3016,953
19benzntech2911,641
20pacocartones249,331
20Prudhvivuda246,312

Frozen at live release/v3.8.50 tip dafb4ae808, with merges through 2026-08-24 05:26:03 UTC. The paginated GitHub GraphQL census contains 5,911 merged PRs: 2,707 by the repository owner, 179 by Dependabot, and 3,025 external PRs from 535 distinct contributors. “Changed lines” is GitHub additions + deletions and includes generated files, lockfiles, catalogs, translations and documentation; it is churn, not authored LOC. Ties at the cutoff are retained.

GitHub-attributed commits

backryun
backryun

🥇 220 GitHub-attributed commits
Paijo
Paijo

🥈 219 GitHub-attributed commits
Randi
Randi

🥉 108 GitHub-attributed commits
Ravi Tharuma
Ravi Tharuma

🏅 81 GitHub-attributed commits
Chris
Chris

🏅 70 GitHub-attributed commits
Markus Hartung
Markus Hartung

🏅 69 GitHub-attributed commits · tied #6
Dizzle
Dizzle

🏅 69 GitHub-attributed commits · tied #6
Jan Leon
Jan Leon

🏅 64 GitHub-attributed commits
zenobit
zenobit

🏅 62 GitHub-attributed commits
Bob.Hou
Bob.Hou

🏅 51 GitHub-attributed commits · tied #10
Xiangzhe
Xiangzhe

🏅 51 GitHub-attributed commits · tied #10

Rechecked at 2026-08-24 06:14:31 UTC: GitHub-attributed commits reported by the repository Contributors API for the release/v3.8.50 default branch. The API returned 525 identities (415 users, 2 bots, 108 anonymous); this table excludes the maintainer, bots and anonymous identities and retains competition ties. It is distinct from both the merged-PR ranking above and the 639-person Git-metadata census below.

🙏 These contributors' features, bug fixes, and infrastructure improvements are a core part of what makes OmniRoute reliable and feature-rich. Every pull request, every test case, and every i18n translation file matters. Open source is built by people like them.



💖 Sponsors

A heartfelt thank-you to the people who fund OmniRoute out of their own pocket — every contribution keeps the project free, independent and moving.

Andrew
Andrew

💛 Active monthly sponsor
Vlad I
Vlad I

💛 Active monthly sponsor
Paco Cartones
Paco Cartones

💛 Active one-time sponsor
Professor Igor Morais Vasconcelos
Prof. Igor Morais

💛 Past one-time supporter
longtao
longtao

💛 Past one-time supporter

… and others who prefer to stay private 💛

Public GitHub Sponsors revalidated on 2026-08-24. GitHub's activeOnly status determines the active labels above; previously disclosed public one-time supporters remain thanked, and private sponsors remain anonymous.

💖 Become a sponsor → — every dollar keeps OmniRoute free and independent.


👥 600+ Contributors

Contributors

Audited on 2026-08-24 at frozen base ac02c5b42f and rechecked at live release/v3.8.50 tip dafb4ae808: 639 normalized human Git identities — 407 appear as commit authors (including the maintainer) and 232 only in explicit Co-authored-by trailers. The census normalizes GitHub noreply handles, excludes 26 bot/agent/service/placeholder identities, and does not merge ordinary email addresses merely because their display names match.

How to Contribute

  1. Fork the repository
  2. Branch from the active release/vX.Y.Z tip (not main) — see Branching & Release Model
  3. Create your feature branch (git checkout -b feat/amazing-feature)
  4. Commit your changes (git commit -m 'feat: add amazing feature')
  5. Push to the branch (git push origin feat/amazing-feature)
  6. Open a Pull Request with base = that release/vX.Y.Z branch

See CONTRIBUTING.md for detailed guidelines.

Releasing a New Version

# Create a release — npm publish happens automatically
VERSION=x.y.z
gh release create "v${VERSION}" --title "v${VERSION}" --generate-notes

📊 Stars

Star History Chart

🌍 StarMapper

StarMapper

🙏 Acknowledgments

OmniRoute stands on the shoulders of giants. It started as a fork of 9router and a TypeScript port of the Go project CLIProxyAPI — and from there, every subsystem below was inspired by an open-source project that got there first. Each one shaped a concrete piece of OmniRoute. This is our thank-you to all of them. 🙏

⭐ star counts verified from GitHub's REST API on August 24, 2026 — go give these projects a star. Counts are an exact dated snapshot and will naturally change.

🧬 Lineage & gateway

Project⭐How it inspired OmniRoute
9router26,161The original project this fork is built on — extended here with multi-modal APIs and a full TypeScript rewrite.
CLIProxyAPI48,497The Go implementation that inspired this JavaScript / TypeScript port.
LiteLLM57,100The AI gateway whose public pricing dataset feeds our cost-tracking sync and whose provider-normalization model informed our routing.
codex-chatgpt-web1,410MIT source adapted into the vendored ChatGPT Web → Codex Responses bridge, including browser-session, response-framing, usage and web-search adapters.
free-claude-code48,112Patterns ported into stream recovery, no-thinking aliases, fallback web search, sliding-window limits, log redaction and hardened launcher flows.
composer-api322Cursor Composer tool-choice, output-constraint and tool-commit patterns adapted into the native Cursor executor.
codex-multi-auth457Fresh-login and refresh-token rotation patterns ported into Codex OAuth reauthentication.
opencode-anthropic-auth510Claude Code-compatible transform defaults and billing-header behavior generalized into OmniRoute's config-driven bridge.
grok2api-merged2Its Grok model mappings, fake-TypeError Statsig generator, request and device defaults, and NDJSON response processor were materially adapted into OmniRoute's Grok Web executor.
TQZHR/grok2api705The principal transitive code source behind grok2api-merged; its model, header, payload, Statsig and processor implementations are preserved in the Grok Web lineage.
chenyme/grok2api7,520The underlying MIT source for Grok payload and device defaults, the Statsig generator, and the result.response processor carried through TQZHR and grok2api-merged.
grok2api-pro27A transitive source credited by grok2api-merged for its proxy-pool layer; OmniRoute preserves that lineage notice but does not claim a proxy-pool port in its bounded Grok Web executor.
GrokProxy50Its cookie-authenticated Grok proxy and result.response.token streaming pattern informed OmniRoute's Grok Web transport.
GrokBridge5The original Grok Web implementation consulted its HTTP/browser upstream design; its direct HTTP path derives from GrokProxy, so no independent code port is claimed.
grok-web-api14Its Rust ChatOptions and response-envelope schemas informed OmniRoute's TypeScript Grok request and streaming-response types.

🗜️ Context & token compression — engines

Project⭐How it inspired OmniRoute
Caveman100,538The viral "why use many token when few token do trick" project — its caveman-speak philosophy powers our standard compression mode and 30+ filler/condensation rules.
RTK – Rust Token Killer77,185High-performance command-output compression — inspired our RTK engine, JSON filter DSL, raw-output recovery and the stacked RTK → Caveman pipeline.
headroom67,310Reversible context-compression (SmartCrusher) — inspired our headroom engine and the ccr retrieve-marker pattern.
LLMLingua6,598Prompt-compression research (LLMLingua / LLMLingua-2) — inspired our async, code-safe, fail-open llmlingua engine.
llmlingua-2-js31The JS/ONNX port (MobileBERT / XLM-RoBERTa) used as the worker-thread backend for our LLMLingua engine.
Troglodita40PT-BR token compression — powers our pt-BR language pack: pleonasm reduction and filler removal tuned for Brazilian-Portuguese grammar.
ponytail108,957The viral "lazy senior dev" YAGNI-coder skill — inspired our less-code Output Style: smallest-working-change steering that cuts _generated_ code (the output-axis sibling to Caveman's terse prose).
i-have-adhd23,526Its action-first, ADHD-friendly response style was adapted into OmniRoute's concise output style across five languages.

🧩 Compact formats, token research & code-aware tooling

Project⭐How it inspired OmniRoute
TOON25,233Token-Oriented Object Notation — its columnar, header-plus-rows model shaped our tabular compaction stage.
GCF – Graph Compact Format41Its compact graph format and generic-profile design informed OmniRoute's tabular compaction and Headroom codec format.
gcf-typescript4The MIT TypeScript implementation directly vendored and extended as the Headroom generic-profile codec.
token-optimizer-mcp494Brotli/SQLite cache + per-session context-delta — inspired our session-dedup engine.
token-savior1,122Bash-output compaction + MCP profiles — inspired our compression bail-out discipline and MCP tool-manifest reduction.
token-saver138Content-aware, per-file-type output compression with failure-aware bail-out — validated our per-type dispatch and minimum-gain skip.
token-optimizer1,951"Find the ghost tokens" — its offload + recoverable-handle pattern informed our CCR offload thinking.
TokenMizer28A session-graph + cross-turn line-dedup blueprint that informed our session-dedup design.
OmniCompress3Rust columnar-JSON + content-addressed retrieve + cross-message dedup — validated our headroom/ccr/session-dedup engine design and the cache-stable "compressed form is position-independent" invariant.
mcp-compressor113MCP tool-schema/description compression — informed our MCP tool-manifest cardinality reduction.
RepoMapper197Aider-style repo-map ranking — informed our repo-map / retrieval-ranking exploration.
quiet-shell-mcp4Declarative shell-output reduction over MCP — validated our declarative bash-output compaction.
ts-morph6,162TypeScript Compiler API toolkit — inspired our parser-based comment removal that preserves string, template and regex literals.

🧠 Memory & RAG

Project⭐How it inspired OmniRoute
Mem063,902Universal memory layer — its proxy-as-write/read-boundary model shaped our memory architecture.
Letta (MemGPT)24,382Stateful agents with tiered memory — inspired our Context Control & Recovery (CCR) tiered model.
WFGY1,781The ProblemMap taxonomy of 16 recurring RAG/LLM failure modes — the shared vocabulary in our troubleshooting guide.

🛰️ Traffic inspection, MITM & transparent proxy

Project⭐How it inspired OmniRoute
llm-interceptor66MITM interception/analysis of coding-assistant ↔ LLM traffic informed early Traffic Inspector requirements. Four previously derived modules — SSE merging, conversation normalization, secret masking and header sanitization — have been replaced by independent clean-room implementations based on public protocol standards. The two host-passthrough surfaces (passthrough.ts and _internal/bypass.cjs) remain OmniRoute-internal implementations classified independently; they were not rewritten as part of that replacement.
ProxyBridge5,995Transparent per-process proxy routing — inspired our crash-safe MITM teardown, socket idle-timeouts, /proc process attribution and TPROXY capture.

📚 Model data, observability & UI

Project⭐How it inspired OmniRoute
models.dev6,555Open database of AI model specs, pricing and capabilities — synced natively into our model catalog.
React Flow / xyflow38,108The node-based graph library powering our real-time Compression Studio and Combo/Routing Studio.
LangGraph40,314LangGraph Studio's live workflow-graph visualization inspired our Studios' real-time cascade view.
Langfuse33,592Its trace → span → generation observability model shaped our Compression Studio waterfall.
Kiali3,631Istio service-mesh observability — inspired our circuit-breaker badges and error-edge visuals in the Routing/Combo Studio.
lobe-icons2,428AI/LLM brand logos that render the provider icons across our dashboard.
flag-icons12,354Provides the MIT-licensed SVG flags used by the README language selector.

🛡️ Security

Project⭐How it inspired OmniRoute
awesome-secure-defaults721A curated list of secure-by-default libraries that guides our security choices (Helmet.js, DOMPurify, ssrf-req-filter, safe-regex, Google Tink).

🧭 Complementary tools

Project⭐How it inspired OmniRoute
ClawRouter6,564Inspired request deduplication, emergency zero-cost fallback, pluggable Auto-Combo strategies and multilingual intent classification.
Antigravity-Manager30,652Its account-aware model remapping, executable-path validation and plan-label behavior informed OmniRoute's Antigravity runtime.
vscode-antigravity-cockpit4,817Its compact quota-reset countdown format inspired the corresponding provider-limit display in OmniRoute.
AionUi32,230Its ACP integrations inspired OmniRoute's automatic detection of installed CLI agents.
CodexBar20,507Identified the Grok Build quota surface; OmniRoute then verified and corrected the live wire format independently.

📄 License

MIT License - see LICENSE for details.


⬆ Back to top · Built with ❤️ for the open-source AI community.

OmniRoute v3.8.52 · Node ≥22.22.2 · MIT License · omniroute.online